Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0761 (AF_0761)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0761 (AF_0761) spans the amino acid sequence from region 1-105.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_0761

UniProt

O29497

Expression Region

1-105

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENIMDEKGQMILLFAFVVVIVVLTLSYVYAQNIIAGVESSRAMLAFPKEEIRNLEEIQK NFGGDSEVNSQIQTLCAKNGWVCYVGVDKVEFKNVEVDYCAGSDC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carboxine
TRC-C177730-25G 25 g

Carboxine

Sign In for Pricing
View Details
MCAM (Melanoma Cell Adhesion Molecule) / MUC18 / CD146 (MCAM/3048), CF647 conjugate, 0.1mg/mL
BNC473048-100 1x 100 µL

MCAM (Melanoma Cell Adhesion Molecule) / MUC18 / CD146 (MCAM/3048), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RALBP1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6C6]
TA500897AM 100 µL

RALBP1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6C6]

Sign In for Pricing
View Details
Octocrylene-d10
TRC-O239756-1MG 1 mg

Octocrylene-d10

Sign In for Pricing
View Details
Vitamin D Binding protein (GC) (NM_000583) Human Over-expression Lysate
LC400197 20 µg

Vitamin D Binding protein (GC) (NM_000583) Human Over-expression Lysate

Sign In for Pricing
View Details
rac-3-Hydroxypentanoic Acid
TRC-H949470-500MG 500 mg

rac-3-Hydroxypentanoic Acid

Sign In for Pricing
View Details