Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Drosophila simulans Vacuolar ATPase assembly integral membrane protein VMA21 (GD14890)

This Recombinant Drosophila simulans Vacuolar ATPase assembly integral membrane protein VMA21 (GD14890) spans the amino acid sequence from region 1-105.

Product Specifications

Product Name Alternative

Vacuolar ATPase assembly integral membrane protein VMA21

UniProt

B4QJ33

Expression Region

1-105

Origin

Drosophila simulans (Fruit fly)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTKNKKAAGGNGGAPKQTRQQSHDSQDYSSFKTVLFYCMLIVFLPVLTFFVLKGFVLDQ FLDISEVKVNIASAVGAVVALHIALGLYIYRAYFGAPGSKGSKTD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (CRIS-7), CF740 conjugate, 0.1mg/mL
BNC741050-100 1x 100 µL

CD3e (CRIS-7), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2729R), CF594 conjugate, 0.1mg/mL
BNC942729-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2729R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (C-04), CF594 conjugate, 0.1mg/mL
BNC940041-100 1x 100 µL

Cytokeratin 18 (C-04), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (57), CF594 conjugate, 0.1mg/mL
BNC940139-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (57), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF405S conjugate, 0.1mg/mL
BNC040345-500 1x 500 µL

CD4 (EDU-2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Beta-2 Microglobulin (B2M) (B2M/961), CF405S conjugate, 0.1mg/mL
BNC040961-500 1x 500 µL

Beta-2 Microglobulin (B2M) (B2M/961), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details