Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein ykvA (ykvA)

This Recombinant Bacillus subtilis Uncharacterized membrane protein ykvA (ykvA) spans the amino acid sequence from region 1-106.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein ykvA

UniProt

O31670

Expression Region

1-106

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKKKAIMLGAAGGKAILKRKNRKKCIQHITTFFQMLRDWRNGDYPRSQVKTLLLLTAAI LYIVMPLDIIPDVILGLGFIDDAAVLGLIWTLIKKELSQYEKWRLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Meiotic Recombination Protein DMC1 LIM15 Homolog (DMC1) ELISA Kit
MBS109584-01 48 Well

Mouse Meiotic Recombination Protein DMC1 LIM15 Homolog (DMC1) ELISA Kit

Sign In for Pricing
View Details
Mouse Meiotic Recombination Protein DMC1 LIM15 Homolog (DMC1) ELISA Kit
MBS109584-02 96 Well

Mouse Meiotic Recombination Protein DMC1 LIM15 Homolog (DMC1) ELISA Kit

Sign In for Pricing
View Details
Mouse Meiotic Recombination Protein DMC1 LIM15 Homolog (DMC1) ELISA Kit
MBS109584-03 5x 96 Well

Mouse Meiotic Recombination Protein DMC1 LIM15 Homolog (DMC1) ELISA Kit

Sign In for Pricing
View Details
Mouse Meiotic Recombination Protein DMC1 LIM15 Homolog (DMC1) ELISA Kit
MBS109584-04 10x 96 Well

Mouse Meiotic Recombination Protein DMC1 LIM15 Homolog (DMC1) ELISA Kit

Sign In for Pricing
View Details
Rabbit Monoclonal SLC45A3/Prostein Antibody (SLC45A3/4965R) [Janelia Fluor 669]
NBP3-14048JF669 0.1 mL

Rabbit Monoclonal SLC45A3/Prostein Antibody (SLC45A3/4965R) [Janelia Fluor 669]

Sign In for Pricing
View Details
GPD1L (NM_015141) Human Over-expression Lysate
LH09565V 100 µg

GPD1L (NM_015141) Human Over-expression Lysate

Sign In for Pricing
View Details