Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein ykvA (ykvA)

This Recombinant Bacillus subtilis Uncharacterized membrane protein ykvA (ykvA) spans the amino acid sequence from region 1-106.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein ykvA

UniProt

O31670

Expression Region

1-106

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKKKAIMLGAAGGKAILKRKNRKKCIQHITTFFQMLRDWRNGDYPRSQVKTLLLLTAAI LYIVMPLDIIPDVILGLGFIDDAAVLGLIWTLIKKELSQYEKWRLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Tstd2 ELISA KIT
ELI-51226m 96 Tests

Mouse Tstd2 ELISA KIT

Sign In for Pricing
View Details
Fyb (H-3) : m-IgG1 BP-HRP Bundle
sc-542447 1 Kit

Fyb (H-3) : m-IgG1 BP-HRP Bundle

Sign In for Pricing
View Details
Ch55-O-C3-NH2
MBS5771508 Inquire

Ch55-O-C3-NH2

Sign In for Pricing
View Details
GHRH Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV691424 1.0 µg DNA

GHRH Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Human MIR527 qPCR Primer Pair
QH80029S 200 Tests

Human MIR527 qPCR Primer Pair

Sign In for Pricing
View Details
Potassium ferrate (VI)
sc-236444A 10 g

Potassium ferrate (VI)

Sign In for Pricing
View Details