Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein ykvA (ykvA)

This Recombinant Bacillus subtilis Uncharacterized membrane protein ykvA (ykvA) spans the amino acid sequence from region 1-106.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein ykvA

UniProt

O31670

Expression Region

1-106

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKKKAIMLGAAGGKAILKRKNRKKCIQHITTFFQMLRDWRNGDYPRSQVKTLLLLTAAI LYIVMPLDIIPDVILGLGFIDDAAVLGLIWTLIKKELSQYEKWRLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N1, N1-diethyl-N2-phenethyl-1,2-ethanediamine
sc-338346 500 mg

N1, N1-diethyl-N2-phenethyl-1,2-ethanediamine

Sign In for Pricing
View Details
Caspase 1 (CASP1) Rabbit Polyclonal Antibody
TA312622 100 µL

Caspase 1 (CASP1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Simax Buchner Flask 1L
FLA38040 8 / PCK

Simax Buchner Flask 1L

Sign In for Pricing
View Details
Bovine Fibroblast Growth Factor 15 ELISA Kit
OM618925 96 Strip Well

Bovine Fibroblast Growth Factor 15 ELISA Kit

Sign In for Pricing
View Details
Goat Anti-Mouse IgG2b Antibody (APC)
orb2987104-01 100 µL

Goat Anti-Mouse IgG2b Antibody (APC)

Sign In for Pricing
View Details
Goat Anti-Mouse IgG2b Antibody (APC)
orb2987104-02 500 µL

Goat Anti-Mouse IgG2b Antibody (APC)

Sign In for Pricing
View Details