Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Avian infectious bronchitis virus Envelope small membrane protein (E)

This Recombinant Avian infectious bronchitis virus Envelope small membrane protein (E) spans the amino acid sequence from region 1-106.

Product Specifications

Product Name Alternative

Envelope small membrane protein, E protein, sM protein, 3c protein

UniProt

P30247

Expression Region

1-106

Origin

Avian infectious bronchitis virus (strain UK/68/84) (IBV)

Field of Research

Infectious Disease & Virology; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMNLLNTSLEENGSFLTALYVICEFVALYLLGRALQAFVQAADACCLFWYTWVVVPGAKG TAFVYKHTYGKKLNNPELEAVIVNEFPKNGWNNKNPANFQNGKLHT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eriodictyol
N2309-20 20 mg

Eriodictyol

Sign In for Pricing
View Details
CAY10503
MBS5785109 Inquire

CAY10503

Sign In for Pricing
View Details
CTRB1/2 (B-3)
sc-398721 200 µg/mL

CTRB1/2 (B-3)

Sign In for Pricing
View Details
Gabbr1 sgRNA CRISPR Lentivector set (Mouse)
K3979201 3x 1.0 µg

Gabbr1 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
CLEC7A Polyclonal Antibody, HRP Conjugated
bs-2455R-HRP-TR 20 µL

CLEC7A Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
GNAO1 Protein Vector (Mouse) (pPB-C-His)
PV185222 500 ng

GNAO1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details