Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bat coronavirus Rp3/2004 Protein 7a (7a)

This Recombinant Bat coronavirus Rp3/2004 Protein 7a (7a) spans the amino acid sequence from region 16-122.

Product Specifications

Product Name Alternative

Protein 7a, Accessory protein 7a

UniProt

Q3I5J0

Expression Region

16-122

Origin

Bat coronavirus Rp3/2004 (BtCoV/Rp3/2004) (SARS-like coronavirus Rp3)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ELYHYQECVRGTTVLLKEPCPSGTYEGNSPFHPLADNKFALTCTSTHFAFACADGTRHTY QLRARSVSPKLFIRQEEVHQELYSPLFLIVAALVFITLCFTIKRKTE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calcein AM
1071E 20x 50 µg

Calcein AM

Sign In for Pricing
View Details
Shank3 Mouse Gene Knockout Kit (CRISPR)
KN515735 1 Kit

Shank3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human ATAD3A activation kit by CRISPRa
GA110608 1 Kit

Human ATAD3A activation kit by CRISPRa

Sign In for Pricing
View Details
Cytokeratin 19 (KRT19) (Pancreatic Stem Cell Marker) (rKRT19/799), CF640R conjugate, 0.1mg/mL
BNC402304-100 1x 100 µL

Cytokeratin 19 (KRT19) (Pancreatic Stem Cell Marker) (rKRT19/799), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Biglycan (BGN) (NM_001711) Human Recombinant Protein
TP761187 50 µg

Biglycan (BGN) (NM_001711) Human Recombinant Protein

Sign In for Pricing
View Details
Septin 3 (SEPT3) Mouse Monoclonal Antibody [Clone ID: OTI3C8]
CF811195 100 µg

Septin 3 (SEPT3) Mouse Monoclonal Antibody [Clone ID: OTI3C8]

Sign In for Pricing
View Details