Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bat coronavirus Rp3/2004 Protein 7a (7a)

This Recombinant Bat coronavirus Rp3/2004 Protein 7a (7a) spans the amino acid sequence from region 16-122.

Product Specifications

Product Name Alternative

Protein 7a, Accessory protein 7a

UniProt

Q3I5J0

Expression Region

16-122

Origin

Bat coronavirus Rp3/2004 (BtCoV/Rp3/2004) (SARS-like coronavirus Rp3)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ELYHYQECVRGTTVLLKEPCPSGTYEGNSPFHPLADNKFALTCTSTHFAFACADGTRHTY QLRARSVSPKLFIRQEEVHQELYSPLFLIVAALVFITLCFTIKRKTE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DySolv
7501A 20 mL

DySolv

Sign In for Pricing
View Details
TFAP2A Antibody
KC-1392-01 50 μL

TFAP2A Antibody

Sign In for Pricing
View Details
TFAP2A Antibody
KC-1392-02 100 µL

TFAP2A Antibody

Sign In for Pricing
View Details
TFAP2A Antibody
KC-1392-03 1 mL

TFAP2A Antibody

Sign In for Pricing
View Details
ortho-Topolin
TRC-T540280-25MG 25 mg

ortho-Topolin

Sign In for Pricing
View Details
RhoGAP (ARHGAP5) Rabbit Polyclonal Antibody
TA373656 100 µL

RhoGAP (ARHGAP5) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details