Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bat coronavirus Rp3/2004 Protein 7a (7a)

This Recombinant Bat coronavirus Rp3/2004 Protein 7a (7a) spans the amino acid sequence from region 16-122.

Product Specifications

Product Name Alternative

Protein 7a, Accessory protein 7a

UniProt

Q3I5J0

Expression Region

16-122

Origin

Bat coronavirus Rp3/2004 (BtCoV/Rp3/2004) (SARS-like coronavirus Rp3)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ELYHYQECVRGTTVLLKEPCPSGTYEGNSPFHPLADNKFALTCTSTHFAFACADGTRHTY QLRARSVSPKLFIRQEEVHQELYSPLFLIVAALVFITLCFTIKRKTE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3,5-di-Tert-butyl-4-hydroxybenzyl Alcohol
TRC-D178155-5G 5 g

3,5-di-Tert-butyl-4-hydroxybenzyl Alcohol

Sign In for Pricing
View Details
Recombinant Cadherin-16 Antibody
RC-15717-01 50 μL

Recombinant Cadherin-16 Antibody

Sign In for Pricing
View Details
Recombinant Cadherin-16 Antibody
RC-15717-02 100 µL

Recombinant Cadherin-16 Antibody

Sign In for Pricing
View Details
Recombinant Cadherin-16 Antibody
RC-15717-03 1 mL

Recombinant Cadherin-16 Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Cecum
CS808524 5x 5 µm

Tissue FFPE Sections, Cecum

Sign In for Pricing
View Details
CD96 Human Gene Knockout Kit (CRISPR)
KN213845LP 1 Kit

CD96 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details