Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rotavirus B Non-structural protein 1, peptide 1

This Recombinant Rotavirus B Non-structural protein 1, peptide 1 spans the amino acid sequence from region 1-107.

Product Specifications

Product Name Alternative

Non-structural protein 1, peptide 1, NSP1 peptide 1, NSP1-1

UniProt

Q86198

Expression Region

1-107

Origin

Rotavirus B (isolate Human/China/ADRV/1982) (RV-B) (Rotavirus B (isolate adult diarrhea rotavirus) )

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGNRQSSAQLNSHLTHINSQNSNLFISDSKTAVFHTQHILLAAGVGIIATLLVLLLCSCV LNCYLCRRLKRTNGVSSLLERNLRQNGSSAKIYVKPVMQSSTIIEEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal IL-6 Antibody (OTI3G9) [Dylight 594]
NBP2-71027DL594 0.1 mL

Mouse Monoclonal IL-6 Antibody (OTI3G9) [Dylight 594]

Sign In for Pricing
View Details
V 352-148X148-B0455 V-shape & L-shape Signs
223999 1 Card (1 Panel (s) x 1 Pack)

V 352-148X148-B0455 V-shape & L-shape Signs

Sign In for Pricing
View Details
VEGFA Polyclonal Antibody
A72297-050 50 µL

VEGFA Polyclonal Antibody

Sign In for Pricing
View Details
ECHS1 3'UTR Lenti-reporter-Luc Vector
18894081 1.0 µg

ECHS1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
SRRM1 (Serine/Arginine Repetitive Matrix 1, 160-KD, POP101, SRM160) (MaxLight 650)
MBS6438945-01 0.1 mL

SRRM1 (Serine/Arginine Repetitive Matrix 1, 160-KD, POP101, SRM160) (MaxLight 650)

Sign In for Pricing
View Details
SRRM1 (Serine/Arginine Repetitive Matrix 1, 160-KD, POP101, SRM160) (MaxLight 650)
MBS6438945-02 5x 0.1 mL

SRRM1 (Serine/Arginine Repetitive Matrix 1, 160-KD, POP101, SRM160) (MaxLight 650)

Sign In for Pricing
View Details