Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rotavirus B Non-structural protein 1, peptide 1

This Recombinant Rotavirus B Non-structural protein 1, peptide 1 spans the amino acid sequence from region 1-107.

Product Specifications

Product Name Alternative

Non-structural protein 1, peptide 1, NSP1 peptide 1, NSP1-1

UniProt

Q86198

Expression Region

1-107

Origin

Rotavirus B (isolate Human/China/ADRV/1982) (RV-B) (Rotavirus B (isolate adult diarrhea rotavirus) )

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGNRQSSAQLNSHLTHINSQNSNLFISDSKTAVFHTQHILLAAGVGIIATLLVLLLCSCV LNCYLCRRLKRTNGVSSLLERNLRQNGSSAKIYVKPVMQSSTIIEEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human HSD17B4, GST-tagged
HSD17B4-13960H 25 µg

Recombinant Human HSD17B4, GST-tagged

Sign In for Pricing
View Details
Pimobendan-d4
HY-B0204S2 1 Each

Pimobendan-d4

Sign In for Pricing
View Details
Recombinant Human B7-H4 / B7S1 / B7x Protein (His tag)
MBS2546107-01 0.1 mg

Recombinant Human B7-H4 / B7S1 / B7x Protein (His tag)

Sign In for Pricing
View Details
Recombinant Human B7-H4 / B7S1 / B7x Protein (His tag)
MBS2546107-02 1 mg

Recombinant Human B7-H4 / B7S1 / B7x Protein (His tag)

Sign In for Pricing
View Details
DHX34 Antibody, FITC conjugated
A55441-100UG 100 µg

DHX34 Antibody, FITC conjugated

Sign In for Pricing
View Details
Research Grade Vonsetamig
DHF92419 100 μg

Research Grade Vonsetamig

Sign In for Pricing
View Details