Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rotavirus B Non-structural protein 1, peptide 1

This Recombinant Rotavirus B Non-structural protein 1, peptide 1 spans the amino acid sequence from region 1-107.

Product Specifications

Product Name Alternative

Non-structural protein 1, peptide 1, NSP1 peptide 1, NSP1-1

UniProt

Q86198

Expression Region

1-107

Origin

Rotavirus B (isolate Human/China/ADRV/1982) (RV-B) (Rotavirus B (isolate adult diarrhea rotavirus) )

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGNRQSSAQLNSHLTHINSQNSNLFISDSKTAVFHTQHILLAAGVGIIATLLVLLLCSCV LNCYLCRRLKRTNGVSSLLERNLRQNGSSAKIYVKPVMQSSTIIEEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human GDI-2 Polyclonal Antibody
PA83341HU-01 50 µg

Rabbit Anti-Human GDI-2 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human GDI-2 Polyclonal Antibody
PA83341HU-02 100 µg

Rabbit Anti-Human GDI-2 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human GDI-2 Polyclonal Antibody
PA83341HU-03 500 µg

Rabbit Anti-Human GDI-2 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human GDI-2 Polyclonal Antibody
PA83341HU-04 1 mg

Rabbit Anti-Human GDI-2 Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Perforin Antibody (PRF1/2470) [Biotin]
NBP2-79886B 0.1 mL

Mouse Monoclonal Perforin Antibody (PRF1/2470) [Biotin]

Sign In for Pricing
View Details
Sil1 Mouse shRNA Plasmid (Locus ID 81500)
TL505388 1 Kit

Sil1 Mouse shRNA Plasmid (Locus ID 81500)

Sign In for Pricing
View Details