Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Manduca sexta Protein Asterix

This Recombinant Manduca sexta Protein Asterix spans the amino acid sequence from region 1-108.

Product Specifications

Product Name Alternative

Protein Asterix

UniProt

Q9U516

Expression Region

1-108

Origin

Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQLTSDPRRADRERRYKPPPSTTAPAEDLTTDYMNILGMVFSMCGLMMRLKWCAWTAVFC SSISFANSRVSDDTKQIVSSFMLSISAVVMSYLQNPSPMSPPWATLTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human OCLN Protein (GST Tag)
PDEH101112-01 20 µg

Recombinant Human OCLN Protein (GST Tag)

Sign In for Pricing
View Details
Recombinant Human OCLN Protein (GST Tag)
PDEH101112-02 100 µg

Recombinant Human OCLN Protein (GST Tag)

Sign In for Pricing
View Details
Recombinant Human OCLN Protein (GST Tag)
PDEH101112-03 500 µg

Recombinant Human OCLN Protein (GST Tag)

Sign In for Pricing
View Details
Recombinant Human OCLN Protein (GST Tag)
PDEH101112-04 1 mg

Recombinant Human OCLN Protein (GST Tag)

Sign In for Pricing
View Details
ODC-1 (Ornithine Decarboxylase-1) (ODC1/486), CF594 conjugate, 0.1mg/mL
BNC940486-500 1x 500 µL

ODC-1 (Ornithine Decarboxylase-1) (ODC1/486), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Spectrin beta III (SPTBN2) (SPTBN2/3142R), CF405S conjugate, 0.1mg/mL
BNC043142-500 1x 500 µL

Spectrin beta III (SPTBN2) (SPTBN2/3142R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details