Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Manduca sexta Protein Asterix

This Recombinant Manduca sexta Protein Asterix spans the amino acid sequence from region 1-108.

Product Specifications

Product Name Alternative

Protein Asterix

UniProt

Q9U516

Expression Region

1-108

Origin

Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQLTSDPRRADRERRYKPPPSTTAPAEDLTTDYMNILGMVFSMCGLMMRLKWCAWTAVFC SSISFANSRVSDDTKQIVSSFMLSISAVVMSYLQNPSPMSPPWATLTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLIC2 (NM_001289) Human Over-expression Lysate
LY420025 100 µg

CLIC2 (NM_001289) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human Peroxiredoxin-4/PRDX4 Protein (His Tag)
PKSH032884-01 10 µg

Recombinant Human Peroxiredoxin-4/PRDX4 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Peroxiredoxin-4/PRDX4 Protein (His Tag)
PKSH032884-02 50 µg

Recombinant Human Peroxiredoxin-4/PRDX4 Protein (His Tag)

Sign In for Pricing
View Details
Mouse Adenylate Cyclase Activating Polypeptide 1, Pituitary (ADCYAP1) ELISA Kit
RDR-ADCYAP1-Mu-01 96 Tests

Mouse Adenylate Cyclase Activating Polypeptide 1, Pituitary (ADCYAP1) ELISA Kit

Sign In for Pricing
View Details
Mouse Adenylate Cyclase Activating Polypeptide 1, Pituitary (ADCYAP1) ELISA Kit
RDR-ADCYAP1-Mu-02 48 Tests

Mouse Adenylate Cyclase Activating Polypeptide 1, Pituitary (ADCYAP1) ELISA Kit

Sign In for Pricing
View Details
α, ω-Bis-Formylpentanamido PEG
112000-6.1G 1 g

α, ω-Bis-Formylpentanamido PEG

Sign In for Pricing
View Details