Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Panicum streak virus Movement protein (V2)

This Recombinant Panicum streak virus Movement protein (V2) spans the amino acid sequence from region 1-108.

Product Specifications

Product Name Alternative

Movement protein, MP

UniProt

Q00336

Expression Region

1-108

Origin

Panicum streak virus (isolate Kenya) (PanSV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDASSQYSALPYPQPPRVPSAAPSAGRLPWSRVGEIVIFTFVSVLALYLLWLWVLKDCIL LLKAQRGRSTEELIFGPGERPPVASADGSRPVPDPSPPVRRDLDLSRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IPI-3063
MBS5755004 Inquire

IPI-3063

Sign In for Pricing
View Details
3,6-Difluoropyrazine-2-carboxamide-13C3
TRC-D356786-25MG 25 mg

3,6-Difluoropyrazine-2-carboxamide-13C3

Sign In for Pricing
View Details
Polyclonal OR52D1 Antibody - C-terminal region
APR12589G 0.05mg

Polyclonal OR52D1 Antibody - C-terminal region

Sign In for Pricing
View Details
Umeclidinium bromide impurity 8
HY-W004415-01 100 mg

Umeclidinium bromide impurity 8

Sign In for Pricing
View Details
Umeclidinium bromide impurity 8
HY-W004415-02 250 mg

Umeclidinium bromide impurity 8

Sign In for Pricing
View Details
Umeclidinium bromide impurity 8
HY-W004415-03 500 mg

Umeclidinium bromide impurity 8

Sign In for Pricing
View Details