Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Panicum streak virus Movement protein (V2)

This Recombinant Panicum streak virus Movement protein (V2) spans the amino acid sequence from region 1-108.

Product Specifications

Product Name Alternative

Movement protein, MP

UniProt

Q00336

Expression Region

1-108

Origin

Panicum streak virus (isolate Kenya) (PanSV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDASSQYSALPYPQPPRVPSAAPSAGRLPWSRVGEIVIFTFVSVLALYLLWLWVLKDCIL LLKAQRGRSTEELIFGPGERPPVASADGSRPVPDPSPPVRRDLDLSRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NSD3 antibody
ANS0804-100 100 µL

Human NSD3 antibody

Sign In for Pricing
View Details
Il1b (NM_008361) Mouse Recombinant Protein
TP720033M 50 µg

Il1b (NM_008361) Mouse Recombinant Protein

Sign In for Pricing
View Details
Lentiviral human LARS2 shRNA (UAS) - Lentiviral human LARS2 shRNA (UAS, RFP) (100)
GTR15163848 1 Vial

Lentiviral human LARS2 shRNA (UAS) - Lentiviral human LARS2 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Thioredoxin 2 Rabbit pAb, Pacific Blue conjugated
orb2877767 100 µL

Thioredoxin 2 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
Recombinant Erwinia tasmaniensis ATP synthase subunit a (atpB)
orb2916496-01 20 µg

Recombinant Erwinia tasmaniensis ATP synthase subunit a (atpB)

Sign In for Pricing
View Details
Recombinant Erwinia tasmaniensis ATP synthase subunit a (atpB)
orb2916496-02 100 µg

Recombinant Erwinia tasmaniensis ATP synthase subunit a (atpB)

Sign In for Pricing
View Details