Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Panicum streak virus Movement protein (V2)

This Recombinant Panicum streak virus Movement protein (V2) spans the amino acid sequence from region 1-108.

Product Specifications

Product Name Alternative

Movement protein, MP

UniProt

Q00336

Expression Region

1-108

Origin

Panicum streak virus (isolate Kenya) (PanSV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDASSQYSALPYPQPPRVPSAAPSAGRLPWSRVGEIVIFTFVSVLALYLLWLWVLKDCIL LLKAQRGRSTEELIFGPGERPPVASADGSRPVPDPSPPVRRDLDLSRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FRA3B sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
20885111 3x 1.0 µg

FRA3B sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
IGFBP1 Rabbit Polyclonal Antibody (FITC)
orb2615623 100 µg

IGFBP1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
CAMK2G Rabbit Polyclonal Antibody
orb514341 100 µg

CAMK2G Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
(3S,5S) -Atorvastatin sodium salt
DHC11838-01 2 mg

(3S,5S) -Atorvastatin sodium salt

Sign In for Pricing
View Details
(3S,5S) -Atorvastatin sodium salt
DHC11838-02 5 mg

(3S,5S) -Atorvastatin sodium salt

Sign In for Pricing
View Details
(3S,5S) -Atorvastatin sodium salt
DHC11838-03 10 mg

(3S,5S) -Atorvastatin sodium salt

Sign In for Pricing
View Details