Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein C19orf77 (C19orf77)

This Recombinant Human Transmembrane protein C19orf77 (C19orf77) spans the amino acid sequence from region 21-130.

Product Specifications

Product Name Alternative

Transmembrane protein C19orf77

UniProt

O75264

Expression Region

21-130

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QQATEHRLKPWLVGLAAVVGFLFIVYLVLLANRLWCSKARAEDEEETTFRMESNLYQDQS EDKREKKEAKEKEEKRKKEKKTAKEGESNLGLDLEEKEPGDHERAKSTVM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HER-2 / CD340 (HRB2/282), CF647 conjugate, 0.1mg/mL
BNC470282-500 1x 500 µL

HER-2 / CD340 (HRB2/282), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cystatin SN (CST1) Human Gene Knockout Kit (CRISPR)
KN202896LP 1 Kit

Cystatin SN (CST1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Bhlhe40 Mouse Gene Knockout Kit (CRISPR)
KN502159 1 Kit

Bhlhe40 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Adrenal gland
CS701157 5x 5 µm

Tissue FFPE Sections, Adrenal gland

Sign In for Pricing
View Details
Human ZNF358 activation kit by CRISPRa
GA115369 1 Kit

Human ZNF358 activation kit by CRISPRa

Sign In for Pricing
View Details
Tangeretin
TRC-T006555-50MG 50 mg

Tangeretin

Sign In for Pricing
View Details