Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein C19orf77 (C19orf77)

This Recombinant Human Transmembrane protein C19orf77 (C19orf77) spans the amino acid sequence from region 21-130.

Product Specifications

Product Name Alternative

Transmembrane protein C19orf77

UniProt

O75264

Expression Region

21-130

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QQATEHRLKPWLVGLAAVVGFLFIVYLVLLANRLWCSKARAEDEEETTFRMESNLYQDQS EDKREKKEAKEKEEKRKKEKKTAKEGESNLGLDLEEKEPGDHERAKSTVM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Protein Lysate, Spleen
CP565683 150 µg

Tissue Protein Lysate, Spleen

Sign In for Pricing
View Details
m-Tyramine Hydrochloride
TRC-T898505-100MG 100 mg

m-Tyramine Hydrochloride

Sign In for Pricing
View Details
HBV Polyclonal Purified Antibody, Colloidal Gold Labeled, 1mL 15nm
GM-603-15 1 mL

HBV Polyclonal Purified Antibody, Colloidal Gold Labeled, 1mL 15nm

Sign In for Pricing
View Details
PPM1D Human Gene Knockout Kit (CRISPR)
KN209328BN 1 Kit

PPM1D Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS642514 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Protein Carbonyl Colorimetric Assay Kit (Tissue and Serum Samples)
E-BC-K117-M-01 48 T (24 samples)

Protein Carbonyl Colorimetric Assay Kit (Tissue and Serum Samples)

Sign In for Pricing
View Details