Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein C19orf77 (C19orf77)

This Recombinant Human Transmembrane protein C19orf77 (C19orf77) spans the amino acid sequence from region 21-130.

Product Specifications

Product Name Alternative

Transmembrane protein C19orf77

UniProt

O75264

Expression Region

21-130

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QQATEHRLKPWLVGLAAVVGFLFIVYLVLLANRLWCSKARAEDEEETTFRMESNLYQDQS EDKREKKEAKEKEEKRKKEKKTAKEGESNLGLDLEEKEPGDHERAKSTVM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bacitracin (>80%)
TRC-B106500-25G 25 g

Bacitracin (>80%)

Sign In for Pricing
View Details
4-Acetylbutyric Acid
TRC-A168440-50G 50 g

4-Acetylbutyric Acid

Sign In for Pricing
View Details
Tissue Total RNA, Ovary: right
CR560029 5 µg

Tissue Total RNA, Ovary: right

Sign In for Pricing
View Details
Mouse Gfer activation kit by CRISPRa
GA200172 1 Kit

Mouse Gfer activation kit by CRISPRa

Sign In for Pricing
View Details
Ccdc184 Mouse Gene Knockout Kit (CRISPR)
KN502696 1 Kit

Ccdc184 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
p53 (TP53) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4C10]
TA805354BM 100 µL

p53 (TP53) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4C10]

Sign In for Pricing
View Details