Recombinant Salmonella paratyphi C Universal stress protein B (uspB)
This Recombinant Salmonella paratyphi C Universal stress protein B (uspB) spans the amino acid sequence from region 1-111.
Product Specifications
Product Name Alternative
Universal stress protein B
UniProt
C0Q145
Expression Region
1-111
Origin
Salmonella paratyphi C (strain RKS4594)
Field of Research
Infectious Disease & Virology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MISTVSLFWALCVVCIVNMARYFSSLRALLVVLRGCDPLLYQYVDGGGFFTTHGQPNKQV RLVWYIYAQRYRDHHDEEFIRRCERVRRQFLLTSALCGLVVVSLIALMIWH
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
R2997-80E-ML650 100 µL
ROC1 (Regulator of Cullins 1, Protein ZYP, RING Box 1, RING Box Protein 1, Ringbox Protein 1, Rbx, 1, RING Finger Protein 75, RNF75, ZYP Protein, Hrt1) (MaxLight 650)
Sign In for Pricing
View Details 
bs-5337R-Cy7 100 µL
Phospho-EIF4EBP1 (Ser111) Polyclonal Antibody, Cy7 Conjugated
Sign In for Pricing
View Details 