Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi C Universal stress protein B (uspB)

This Recombinant Salmonella paratyphi C Universal stress protein B (uspB) spans the amino acid sequence from region 1-111.

Product Specifications

Product Name Alternative

Universal stress protein B

UniProt

C0Q145

Expression Region

1-111

Origin

Salmonella paratyphi C (strain RKS4594)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISTVSLFWALCVVCIVNMARYFSSLRALLVVLRGCDPLLYQYVDGGGFFTTHGQPNKQV RLVWYIYAQRYRDHHDEEFIRRCERVRRQFLLTSALCGLVVVSLIALMIWH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATPAF1 Protein Vector (Rat) (pPM-C-HA)
12826026 500 ng

ATPAF1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
RPS12 Human siRNA Oligo Duplex (Locus ID 6206)
SR304171 1 Kit

RPS12 Human siRNA Oligo Duplex (Locus ID 6206)

Sign In for Pricing
View Details
CHURC1 Lentiviral Activation Particles (h)
sc-417271-LAC 200 µL

CHURC1 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
HSPA4L AAV siRNA Pooled Vector
24003161 1.0 µg

HSPA4L AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Golgi Membrane Protein 1 (GOLM1) Antibody
abx101480-01 100 µL

Golgi Membrane Protein 1 (GOLM1) Antibody

Sign In for Pricing
View Details
Golgi Membrane Protein 1 (GOLM1) Antibody
abx101480-02 200 µL

Golgi Membrane Protein 1 (GOLM1) Antibody

Sign In for Pricing
View Details