Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi C Universal stress protein B (uspB)

This Recombinant Salmonella paratyphi C Universal stress protein B (uspB) spans the amino acid sequence from region 1-111.

Product Specifications

Product Name Alternative

Universal stress protein B

UniProt

C0Q145

Expression Region

1-111

Origin

Salmonella paratyphi C (strain RKS4594)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISTVSLFWALCVVCIVNMARYFSSLRALLVVLRGCDPLLYQYVDGGGFFTTHGQPNKQV RLVWYIYAQRYRDHHDEEFIRRCERVRRQFLLTSALCGLVVVSLIALMIWH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC/CY7-Linked Polyclonal Antibody to Lamin B1 (LMNB1)
MBS2076764-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Lamin B1 (LMNB1)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Lamin B1 (LMNB1)
MBS2076764-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Lamin B1 (LMNB1)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Lamin B1 (LMNB1)
MBS2076764-03 0.5 mL

APC/CY7-Linked Polyclonal Antibody to Lamin B1 (LMNB1)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Lamin B1 (LMNB1)
MBS2076764-04 1 mL

APC/CY7-Linked Polyclonal Antibody to Lamin B1 (LMNB1)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Lamin B1 (LMNB1)
MBS2076764-05 5 mL

APC/CY7-Linked Polyclonal Antibody to Lamin B1 (LMNB1)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Lamin B1 (LMNB1)
MBS2076764-06 5x 5 mL

APC/CY7-Linked Polyclonal Antibody to Lamin B1 (LMNB1)

Sign In for Pricing
View Details