Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Coccidioides immitis Assembly factor CBP4 (CBP4)

This Recombinant Coccidioides immitis Assembly factor CBP4 (CBP4) spans the amino acid sequence from region 1-111.

Product Specifications

Product Name Alternative

Assembly factor CBP4, Cytochrome b mRNA-processing protein 4

UniProt

Q1DHX9

Expression Region

1-111

Origin

Coccidioides immitis (strain RS) (Valley fever fungus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGSAWKWTKMITVGAVVCVGGPMFVNYVRPTEEELFQRFNPELQKRNLANRDKRQQEFDE FVTKLKEYSKSDKPIWVVAKEAEELQKKQQREAALAAKKAAAETPTDKPTQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TMCO2 (NM_001008740) AAV Particle
RC211061A1V 250 µL

Human TMCO2 (NM_001008740) AAV Particle

Sign In for Pricing
View Details
RPL21 Recombinant Protein Antigen
NBP2-13252PEP 0.1 mL

RPL21 Recombinant Protein Antigen

Sign In for Pricing
View Details
Bovine Actin ELISA Kit
MBS2610449-01 48 Well

Bovine Actin ELISA Kit

Sign In for Pricing
View Details
Bovine Actin ELISA Kit
MBS2610449-02 96 Well

Bovine Actin ELISA Kit

Sign In for Pricing
View Details
Bovine Actin ELISA Kit
MBS2610449-03 5x 96 Well

Bovine Actin ELISA Kit

Sign In for Pricing
View Details
Bovine Actin ELISA Kit
MBS2610449-04 10x 96 Well

Bovine Actin ELISA Kit

Sign In for Pricing
View Details