Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycoplasma synoviae ATP synthase subunit c (atpE)

This Recombinant Mycoplasma synoviae ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-111.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q4A5Z9

Expression Region

1-111

Origin

Mycoplasma synoviae (strain 53)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNQLQNLAEALSASSPVSGTVQTVVDGNTTTTTTTNTGLGVVAVGAGLAMIGAIGSGLGQ GYAAGKTVEAVGRNPEMISKIRATFIIGAGIAETASIYSFIVALLLIFVGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCSF Receptor (CSF1R) Human Gene Knockout Kit (CRISPR)
KN205288 1 Kit

MCSF Receptor (CSF1R) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Plexin D1 (PLXND1) Human Gene Knockout Kit (CRISPR)
KN216518RB 1 Kit

Plexin D1 (PLXND1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CLECL1 Human Gene Knockout Kit (CRISPR)
KN210857BN 1 Kit

CLECL1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
C1orf226 Antibody
KC-43288-01 50 μL

C1orf226 Antibody

Sign In for Pricing
View Details
C1orf226 Antibody
KC-43288-02 100 µL

C1orf226 Antibody

Sign In for Pricing
View Details
C1orf226 Antibody
KC-43288-03 1 mL

C1orf226 Antibody

Sign In for Pricing
View Details