Recombinant Mycoplasma synoviae ATP synthase subunit c (atpE)
This Recombinant Mycoplasma synoviae ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-111.
Product Specifications
Product Name Alternative
ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein
UniProt
Q4A5Z9
Expression Region
1-111
Origin
Mycoplasma synoviae (strain 53)
Field of Research
Infectious Disease & Virology; Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MNQLQNLAEALSASSPVSGTVQTVVDGNTTTTTTTNTGLGVVAVGAGLAMIGAIGSGLGQ GYAAGKTVEAVGRNPEMISKIRATFIIGAGIAETASIYSFIVALLLIFVGK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TA362582 100 µL
Apoptosis repressor with CARD (NOL3) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
BNCB0860-100 1x 100 µL
Human Lambda Light Chain (Lamb14), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 