Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycoplasma synoviae ATP synthase subunit c (atpE)

This Recombinant Mycoplasma synoviae ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-111.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q4A5Z9

Expression Region

1-111

Origin

Mycoplasma synoviae (strain 53)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNQLQNLAEALSASSPVSGTVQTVVDGNTTTTTTTNTGLGVVAVGAGLAMIGAIGSGLGQ GYAAGKTVEAVGRNPEMISKIRATFIIGAGIAETASIYSFIVALLLIFVGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Il4i1 activation kit by CRISPRa
GA201421 1 Kit

Mouse Il4i1 activation kit by CRISPRa

Sign In for Pricing
View Details
ATP6V1E1 (NM_001039367) Human Over-expression Lysate
LC422039 20 µg

ATP6V1E1 (NM_001039367) Human Over-expression Lysate

Sign In for Pricing
View Details
PE Anti-Human CD33 Antibody[6C5]
E-AB-F1083D-01 20 Tests

PE Anti-Human CD33 Antibody[6C5]

Sign In for Pricing
View Details
PE Anti-Human CD33 Antibody[6C5]
E-AB-F1083D-02 100 Tests

PE Anti-Human CD33 Antibody[6C5]

Sign In for Pricing
View Details
PE Anti-Human CD33 Antibody[6C5]
E-AB-F1083D-03 2x 100 Tests

PE Anti-Human CD33 Antibody[6C5]

Sign In for Pricing
View Details
DAX-J2™ Ratio 580/460
16310-AAT 1 mg

DAX-J2™ Ratio 580/460

Sign In for Pricing
View Details