Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pasteurella multocida Uncharacterized protein PM1386 (PM1386)

This Recombinant Pasteurella multocida Uncharacterized protein PM1386 (PM1386) spans the amino acid sequence from region 1-112.

Product Specifications

Product Name Alternative

Uncharacterized protein PM1386

UniProt

Q9CL57

Expression Region

1-112

Origin

Pasteurella multocida (strain Pm70)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAQGYAWFCCASNSSTRFSNATNFSRVRINTCVCTSNSSRVTKSSFANCACNVCLSLASA SCPKSLIPCGRESWICCITCSIFFGFSIIASYFLKFHLLYVILLQIKTFFRD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NIT2 Peptide - middle region
MBS3246551-01 0.1 mg

NIT2 Peptide - middle region

Sign In for Pricing
View Details
NIT2 Peptide - middle region
MBS3246551-02 5x 0.1 mg

NIT2 Peptide - middle region

Sign In for Pricing
View Details
Rabbit Polyclonal Lipocalin-1 Antibody [Allophycocyanin]
NBP2-99834APC 0.1 mL

Rabbit Polyclonal Lipocalin-1 Antibody [Allophycocyanin]

Sign In for Pricing
View Details
Mouse Monoclonal Cystatin A Antibody (1B12) [DyLight 405]
NBP2-59470V 0.1 mL

Mouse Monoclonal Cystatin A Antibody (1B12) [DyLight 405]

Sign In for Pricing
View Details
MRLC1/MRLC2 Antibody
AF9118-01 100 µL

MRLC1/MRLC2 Antibody

Sign In for Pricing
View Details
MRLC1/MRLC2 Antibody
AF9118-02 200 µL

MRLC1/MRLC2 Antibody

Sign In for Pricing
View Details