Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein ygaM (ygaM)

This Recombinant Uncharacterized protein ygaM (ygaM) spans the amino acid sequence from region 1-113.

Product Specifications

Product Name Alternative

Uncharacterized protein ygaM

UniProt

P0ADQ8

Expression Region

1-113

Origin

Escherichia coli O6

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGDHMFNRPNRNDVDDGVQDIQNDVNQLADSLESVLKSWGSDAKGEAEAARSKAQALLKE TRARMHGRTRVQQAARDAVGCADSFVRERPWCSVGTAAAVGIFIGALLSMRKS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ihh (C-term) Rabbit pAb
E2611039 100 µL

Ihh (C-term) Rabbit pAb

Sign In for Pricing
View Details
MAPK8IP3 Protein Vector (Mouse) (pPM-C-His)
PV199165 500 ng

MAPK8IP3 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
anti-NFAT2
YF-PA24233 50 ul

anti-NFAT2

Sign In for Pricing
View Details
GOLIM4 Knockout jurkat Polyclonal Cells
ARG34167 1 Million

GOLIM4 Knockout jurkat Polyclonal Cells

Sign In for Pricing
View Details
Lentiviral human IGF1 sgRNA gene knockout kit - Lentiviral human IGF1 sgRNA gene knockout kit (plasmid)
GTR15371840 1 Vial

Lentiviral human IGF1 sgRNA gene knockout kit - Lentiviral human IGF1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
FA96A rabbit pAb
UB-GEN-8731 100 µL

FA96A rabbit pAb

Sign In for Pricing
View Details