Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein ygaM (ygaM)

This Recombinant Uncharacterized protein ygaM (ygaM) spans the amino acid sequence from region 1-113.

Product Specifications

Product Name Alternative

Uncharacterized protein ygaM

UniProt

P0ADQ8

Expression Region

1-113

Origin

Escherichia coli O6

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGDHMFNRPNRNDVDDGVQDIQNDVNQLADSLESVLKSWGSDAKGEAEAARSKAQALLKE TRARMHGRTRVQQAARDAVGCADSFVRERPWCSVGTAAAVGIFIGALLSMRKS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP47 (Ubiquitin Carboxyl-Terminal Hydrolase 47, Deubiquitinating Enzyme 47, Ubiquitin Thioesterase 47, Ubiquitin-specific-processing Protease 47, USP47)
302832 200 µL

USP47 (Ubiquitin Carboxyl-Terminal Hydrolase 47, Deubiquitinating Enzyme 47, Ubiquitin Thioesterase 47, Ubiquitin-specific-processing Protease 47, USP47)

Sign In for Pricing
View Details
NUB1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1462706 1.0 µg DNA

NUB1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Rabbit BMP Binding Endothelial Regulator ELISA Kit
MBS049570 Inquire

Rabbit BMP Binding Endothelial Regulator ELISA Kit

Sign In for Pricing
View Details
Recombinant Lachesis muta muta Phospholipase A2 LM-PLA2-II
MBS1234895-01 0.02 mg (E-Coli)

Recombinant Lachesis muta muta Phospholipase A2 LM-PLA2-II

Sign In for Pricing
View Details
Recombinant Lachesis muta muta Phospholipase A2 LM-PLA2-II
MBS1234895-02 0.1 mg (E-Coli)

Recombinant Lachesis muta muta Phospholipase A2 LM-PLA2-II

Sign In for Pricing
View Details
Recombinant Lachesis muta muta Phospholipase A2 LM-PLA2-II
MBS1234895-03 0.02 mg (Yeast)

Recombinant Lachesis muta muta Phospholipase A2 LM-PLA2-II

Sign In for Pricing
View Details