Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Na (+) /H (+) antiporter subunit C

This Recombinant Bacillus subtilis Na (+) /H (+) antiporter subunit C spans the amino acid sequence from region 1-113.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit C, Mrp complex subunit C, Multiple resistance and pH homeostasis protein C

UniProt

O05260

Expression Region

1-113

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEILMAVLAGIIFMAATYLLLSKSLLRVIIGTALLSHGVHLMLLTMGGLKKGAAPILSEH AKSFVDPLPQALILTAIVISFGVTSFILVMAFRAYQELKSDDMDQMRGNDQHE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp101 Mouse Gene Knockout Kit (CRISPR)
KN519714 1 Kit

Zfp101 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human SULT1A2 Protein (His Tag)
PKSH033085-01 10 µg

Recombinant Human SULT1A2 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human SULT1A2 Protein (His Tag)
PKSH033085-02 50 µg

Recombinant Human SULT1A2 Protein (His Tag)

Sign In for Pricing
View Details
Stanniocalcin 1 (STC1) (C-term) Rabbit Polyclonal Antibody
AP54070PU-N 400 µL

Stanniocalcin 1 (STC1) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
C1QA / Complement C1q A-Chain (C1QA/2954), CF640R conjugate, 0.1mg/mL
BNC402954-100 1x 100 µL

C1QA / Complement C1q A-Chain (C1QA/2954), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CO2 Incubator Water Jacketed BCWJ-8502
BCWJ-8502 1 Unit

CO2 Incubator Water Jacketed BCWJ-8502

Sign In for Pricing
View Details