Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Na (+) /H (+) antiporter subunit C

This Recombinant Bacillus subtilis Na (+) /H (+) antiporter subunit C spans the amino acid sequence from region 1-113.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit C, Mrp complex subunit C, Multiple resistance and pH homeostasis protein C

UniProt

O05260

Expression Region

1-113

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEILMAVLAGIIFMAATYLLLSKSLLRVIIGTALLSHGVHLMLLTMGGLKKGAAPILSEH AKSFVDPLPQALILTAIVISFGVTSFILVMAFRAYQELKSDDMDQMRGNDQHE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PI 3 Kinase Class 3 (PIK3C3) Human Knockdown Lysate
LY300390 100 µg

PI 3 Kinase Class 3 (PIK3C3) Human Knockdown Lysate

Sign In for Pricing
View Details
1-Octanol
TRC-O237900-50ML 50 mL

1-Octanol

Sign In for Pricing
View Details
CBLIF Antibody (Biotin)
KB-22745-01 50 μL

CBLIF Antibody (Biotin)

Sign In for Pricing
View Details
CBLIF Antibody (Biotin)
KB-22745-02 100 µL

CBLIF Antibody (Biotin)

Sign In for Pricing
View Details
CBLIF Antibody (Biotin)
KB-22745-03 1 mL

CBLIF Antibody (Biotin)

Sign In for Pricing
View Details
Tissue Total RNA, Lymphoid tissue
CR561588 5 µg

Tissue Total RNA, Lymphoid tissue

Sign In for Pricing
View Details