Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus haemolyticus Na (+) /H (+) antiporter subunit C1 (mnhC1)

This Recombinant Staphylococcus haemolyticus Na (+) /H (+) antiporter subunit C1 (mnhC1) spans the amino acid sequence from region 1-113.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit C1, Mnh complex subunit C1

UniProt

Q4L4W5

Expression Region

1-113

Origin

Staphylococcus haemolyticus (strain JCSC1435)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIIMIFVCGILASISVYLVLSKSLIRIVMGTTLITHASNLFLITMGGLKHGEMPIYEKN ISQYVDPIPHALILTAIVIAFATTAFFLVLAFRTYKELGTDNVERMKGVLDDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5,24-Stigmastadienol
TRC-S121095-5MG 5 mg

5,24-Stigmastadienol

Sign In for Pricing
View Details
Butyric-3,3,4,4,4-d5 Acid
TRC-B692246-10MG 10 mg

Butyric-3,3,4,4,4-d5 Acid

Sign In for Pricing
View Details
(Z)-11-Octadecenoic Acid (Solution in Ethanol)
TRC-O860075-250MG 250 mg

(Z)-11-Octadecenoic Acid (Solution in Ethanol)

Sign In for Pricing
View Details
7,8-Dihydro-1-naphthalenol
TRC-D451130-250MG 250 mg

7,8-Dihydro-1-naphthalenol

Sign In for Pricing
View Details
GNAZ Polyclonal Antibody
E-AB-90021-01 60 µL

GNAZ Polyclonal Antibody

Sign In for Pricing
View Details
GNAZ Polyclonal Antibody
E-AB-90021-02 120 µL

GNAZ Polyclonal Antibody

Sign In for Pricing
View Details