Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus haemolyticus Na (+) /H (+) antiporter subunit C1 (mnhC1)

This Recombinant Staphylococcus haemolyticus Na (+) /H (+) antiporter subunit C1 (mnhC1) spans the amino acid sequence from region 1-113.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit C1, Mnh complex subunit C1

UniProt

Q4L4W5

Expression Region

1-113

Origin

Staphylococcus haemolyticus (strain JCSC1435)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIIMIFVCGILASISVYLVLSKSLIRIVMGTTLITHASNLFLITMGGLKHGEMPIYEKN ISQYVDPIPHALILTAIVIAFATTAFFLVLAFRTYKELGTDNVERMKGVLDDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SRP19 (NM_003135) Human Over-expression Lysate
LY418878 100 µg

SRP19 (NM_003135) Human Over-expression Lysate

Sign In for Pricing
View Details
Cytokeratin 19 (KRT19/799), CF594 conjugate, 0.1mg/mL
BNC940799-500 1x 500 µL

Cytokeratin 19 (KRT19/799), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human XEDAR/EDA2R Protein (His Tag)
PKSH030983 100 µg

Recombinant Human XEDAR/EDA2R Protein (His Tag)

Sign In for Pricing
View Details
TXNRD1 Antibody
KC-29515-01 50 μL

TXNRD1 Antibody

Sign In for Pricing
View Details
TXNRD1 Antibody
KC-29515-02 100 µL

TXNRD1 Antibody

Sign In for Pricing
View Details
TXNRD1 Antibody
KC-29515-03 1 mL

TXNRD1 Antibody

Sign In for Pricing
View Details