Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit dad1 (dad1)

This Recombinant Xenopus laevis Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit dad1 (dad1) spans the amino acid sequence from region 1-113.

Product Specifications

Product Name Alternative

Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit dad1, Oligosaccharyl transferase subunit dad1, EC= 2.4.1.119, Defender against cell death 1, DAD

UniProt

P46967

Expression Region

1-113

Origin

Xenopus laevis (African clawed frog)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVSVFSVVSRFLDEYVSSTPQRLKLLDAYLLYILLTGALQFLYCLLVGTFPFNSFLSGF ISSVGSFILAVCLRIQINPQNKSDFQGISPERAFADFLFANTILHLVVVNFIG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PREB Antibody
KC-7739-01 50 μL

PREB Antibody

Sign In for Pricing
View Details
PREB Antibody
KC-7739-02 100 µL

PREB Antibody

Sign In for Pricing
View Details
PREB Antibody
KC-7739-03 1 mL

PREB Antibody

Sign In for Pricing
View Details
9-cis-Retinol Acetate-d5 (>80%)
TRC-R252102-5MG 5 mg

9-cis-Retinol Acetate-d5 (>80%)

Sign In for Pricing
View Details
MEF2D Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI10B4]
TA807652BM 100 µL

MEF2D Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI10B4]

Sign In for Pricing
View Details
Butyrylglycine-d7
TRC-B693772-25MG 25 mg

Butyrylglycine-d7

Sign In for Pricing
View Details