Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Putative antiporter subunit mnhC2 (mnhc2)

This Recombinant Putative antiporter subunit mnhC2 (mnhc2) spans the amino acid sequence from region 1-114.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhC2, Mrp complex subunit C2, Putative NADH-ubiquinone oxidoreductase subunit mnhC2

UniProt

Q0Q2J8

Expression Region

1-114

Origin

Staphylococcus aureus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLILLLVIGFLVFIGTYMILSINLIRIVIGISIYTHAGNLIIMSMGTYGSSRSEPLITG GNQLFVDPLLQAIVLTAIVIGFGMTAFLLVLVYRTYKVTKEDEIEGLRGEDDAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cysteine protease inhibitor 5 Antibody
orb858465 2 mg

Cysteine protease inhibitor 5 Antibody

Sign In for Pricing
View Details
CIAO1 (NM_004804) Human Tagged ORF Clone Lentiviral Particle
RC207586L3V 200 µL

CIAO1 (NM_004804) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CHST15 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV669029 1.0 µg DNA

CHST15 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Anti-Retinoid X Receptor alpha/RXRA Antibody Picoband® (monoclonal, 5E7) Fluoro550 Conjugated
M01299-Fluoro550 100 µg/Vial

Anti-Retinoid X Receptor alpha/RXRA Antibody Picoband® (monoclonal, 5E7) Fluoro550 Conjugated

Sign In for Pricing
View Details
Recombinant Human MARCHF10 Protein
E30P64757B 50 µg

Recombinant Human MARCHF10 Protein

Sign In for Pricing
View Details
2- (3-Fluorophenyl) azepane
PC901191 1 Each

2- (3-Fluorophenyl) azepane

Sign In for Pricing
View Details