Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Putative antiporter subunit mnhC2 (mnhc2)

This Recombinant Putative antiporter subunit mnhC2 (mnhc2) spans the amino acid sequence from region 1-114.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhC2, Mrp complex subunit C2, Putative NADH-ubiquinone oxidoreductase subunit mnhC2

UniProt

Q0Q2J8

Expression Region

1-114

Origin

Staphylococcus aureus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLILLLVIGFLVFIGTYMILSINLIRIVIGISIYTHAGNLIIMSMGTYGSSRSEPLITG GNQLFVDPLLQAIVLTAIVIGFGMTAFLLVLVYRTYKVTKEDEIEGLRGEDDAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C9orf152 Human Over-expression Lysate
orb1363102 20 µg

C9orf152 Human Over-expression Lysate

Sign In for Pricing
View Details
Ugt2b sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6863505 3x 1.0 µg

Ugt2b sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Fam151b (NM_001163627) Mouse Tagged ORF Clone
MG214353 10 µg

Fam151b (NM_001163627) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
LCE1E (NM_178353) Human Tagged Lenti ORF Clone
RC213866L4 10 µg

LCE1E (NM_178353) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Lymphocytic choriomeningitis virus Pre-glycoprotein polyprotein GP complex (GPC) , partial
CSB-CF357830LKW(A4)-01 20 µg

Recombinant Lymphocytic choriomeningitis virus Pre-glycoprotein polyprotein GP complex (GPC) , partial

Sign In for Pricing
View Details
Recombinant Lymphocytic choriomeningitis virus Pre-glycoprotein polyprotein GP complex (GPC) , partial
CSB-CF357830LKW(A4)-02 100 µg

Recombinant Lymphocytic choriomeningitis virus Pre-glycoprotein polyprotein GP complex (GPC) , partial

Sign In for Pricing
View Details