Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Putative antiporter subunit mnhC2 (mnhc2)

This Recombinant Putative antiporter subunit mnhC2 (mnhc2) spans the amino acid sequence from region 1-114.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhC2, Mrp complex subunit C2, Putative NADH-ubiquinone oxidoreductase subunit mnhC2

UniProt

Q0Q2J8

Expression Region

1-114

Origin

Staphylococcus aureus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLILLLVIGFLVFIGTYMILSINLIRIVIGISIYTHAGNLIIMSMGTYGSSRSEPLITG GNQLFVDPLLQAIVLTAIVIGFGMTAFLLVLVYRTYKVTKEDEIEGLRGEDDAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MGAT5 Knockout Hela Polyclonal Cells
ARG8271 1 Million

MGAT5 Knockout Hela Polyclonal Cells

Sign In for Pricing
View Details
Collection head for Hamer Floating Emergence Trap
619.5 1 Each

Collection head for Hamer Floating Emergence Trap

Sign In for Pricing
View Details
GAA Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-13254R-APC-Cy5.5 100 µL

GAA Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
VPS39 shRNA Plasmid (h)
sc-90114-SH 20 µg

VPS39 shRNA Plasmid (h)

Sign In for Pricing
View Details
TTTY26P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV754832 1.0 µg DNA

TTTY26P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
MDGA2 ORF Vector (Human) (pORF)
ORF023406 1.0 µg DNA

MDGA2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details