Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Putative antiporter subunit mnhC2 (mnhc2)

This Recombinant Staphylococcus epidermidis Putative antiporter subunit mnhC2 (mnhc2) spans the amino acid sequence from region 1-114.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhC2, Mrp complex subunit C2, Putative NADH-ubiquinone oxidoreductase subunit mnhC2

UniProt

Q8CQ48

Expression Region

1-114

Origin

Staphylococcus epidermidis (strain ATCC 12228)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLILLLVIGFLVFIGTYMILSINLIRIVIGISIYTHAGNLIIMSMGKYGPHMSEPLIQG HAQNFVDPLLQAIVLTAIVIGFGMTAFLLVLIYRTYRVTKEDEISALKGDEDDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLUR4 Rabbit Polyclonal Antibody (Cy5.5)
orb1050647 100 µL

GLUR4 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
PRSS33 (Serine Protease 33, 3421-, Serine Protease EOS, PRSS33) (MaxLight 550)
MBS6458501-01 0.1 mL

PRSS33 (Serine Protease 33, 3421-, Serine Protease EOS, PRSS33) (MaxLight 550)

Sign In for Pricing
View Details
PRSS33 (Serine Protease 33, 3421-, Serine Protease EOS, PRSS33) (MaxLight 550)
MBS6458501-02 5x 0.1 mL

PRSS33 (Serine Protease 33, 3421-, Serine Protease EOS, PRSS33) (MaxLight 550)

Sign In for Pricing
View Details
Methyl Salicylate β-D-O-Glucuronide Methyl Ester
017401 10 mg

Methyl Salicylate β-D-O-Glucuronide Methyl Ester

Sign In for Pricing
View Details
LSM6 Rabbit Polyclonal Antibody (Biotin)
orb2125027 100 µL

LSM6 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
C3orf49 Rabbit pAb, AE conjugated
orb2855239 100 µL

C3orf49 Rabbit pAb, AE conjugated

Sign In for Pricing
View Details