Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Putative antiporter subunit mnhC2 (mnhc2)

This Recombinant Staphylococcus epidermidis Putative antiporter subunit mnhC2 (mnhc2) spans the amino acid sequence from region 1-114.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhC2, Mrp complex subunit C2, Putative NADH-ubiquinone oxidoreductase subunit mnhC2

UniProt

Q8CQ48

Expression Region

1-114

Origin

Staphylococcus epidermidis (strain ATCC 12228)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLILLLVIGFLVFIGTYMILSINLIRIVIGISIYTHAGNLIIMSMGKYGPHMSEPLIQG HAQNFVDPLLQAIVLTAIVIGFGMTAFLLVLIYRTYRVTKEDEISALKGDEDDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL31P53 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV779785 1.0 µg DNA

RPL31P53 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Goat Rad17 Antibody
orb1520441-01 10 µL

Goat Rad17 Antibody

Sign In for Pricing
View Details
Goat Rad17 Antibody
orb1520441-02 100 µL

Goat Rad17 Antibody

Sign In for Pricing
View Details
Human PODXL Knockout A549 cell line
GTR15402337 1 Vial

Human PODXL Knockout A549 cell line

Sign In for Pricing
View Details
GOLGA8J 3'UTR Luciferase Stable Cell Line
TU009068 1.0 mL

GOLGA8J 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Metabotropic glutamate Receptor 6 (GRM6) Rabbit ELISA Kit
E9476 96 Tests

Metabotropic glutamate Receptor 6 (GRM6) Rabbit ELISA Kit

Sign In for Pricing
View Details