Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Na (+) /H (+) antiporter subunit C1 (mnhC1)

This Recombinant Staphylococcus epidermidis Na (+) /H (+) antiporter subunit C1 (mnhC1) spans the amino acid sequence from region 1-115.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit C1, Mnh complex subunit C1

UniProt

Q5HQL2

Expression Region

1-115

Origin

Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIIMIFVSGILTSISVYLVLSKSLIRIIMGTTLLTHAANLFLITMGGLKHGTVPIFEKG TSSYVDPIPQALILTAIVIAFATTAFFLVLAFRTYKELGTDNVELMKGAPEDDRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

mmu-miR-770-3p miRNA Inhibitor
MBS8295736-01 10 nmol

mmu-miR-770-3p miRNA Inhibitor

Sign In for Pricing
View Details
mmu-miR-770-3p miRNA Inhibitor
MBS8295736-02 20 nmol

mmu-miR-770-3p miRNA Inhibitor

Sign In for Pricing
View Details
mmu-miR-770-3p miRNA Inhibitor
MBS8295736-03 5x 20 nmol

mmu-miR-770-3p miRNA Inhibitor

Sign In for Pricing
View Details
Rabggtb sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6928707 1.0 µg DNA

Rabggtb sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
S-4-Fluoro-2- ((3-methyl-2,4-dioxo-6- (piperidin-3-ylamino) -3,4-dihydropyrimidin-1 (2H) -yl) methyl) benzonitrile
465487-01 1 mg

S-4-Fluoro-2- ((3-methyl-2,4-dioxo-6- (piperidin-3-ylamino) -3,4-dihydropyrimidin-1 (2H) -yl) methyl) benzonitrile

Sign In for Pricing
View Details
S-4-Fluoro-2- ((3-methyl-2,4-dioxo-6- (piperidin-3-ylamino) -3,4-dihydropyrimidin-1 (2H) -yl) methyl) benzonitrile
465487-02 2.5 mg

S-4-Fluoro-2- ((3-methyl-2,4-dioxo-6- (piperidin-3-ylamino) -3,4-dihydropyrimidin-1 (2H) -yl) methyl) benzonitrile

Sign In for Pricing
View Details