Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Na (+) /H (+) antiporter subunit C1 (mnhC1)

This Recombinant Staphylococcus epidermidis Na (+) /H (+) antiporter subunit C1 (mnhC1) spans the amino acid sequence from region 1-115.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit C1, Mnh complex subunit C1

UniProt

Q5HQL2

Expression Region

1-115

Origin

Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIIMIFVSGILTSISVYLVLSKSLIRIIMGTTLLTHAANLFLITMGGLKHGTVPIFEKG TSSYVDPIPQALILTAIVIAFATTAFFLVLAFRTYKELGTDNVELMKGAPEDDRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-GATA1 Antibody Picoband® Fluoro550 Conjugated
A00408-2-Fluoro550 100 µg/Vial

Anti-GATA1 Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
Menin Rabbit mAb
E45R11895N 50 ul

Menin Rabbit mAb

Sign In for Pricing
View Details
IL20RB AAV Vector (Human) (CMV)
24860101 1 µg

IL20RB AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Phenanthrene, decafluoro-
T33963-01 100 mg

Phenanthrene, decafluoro-

Sign In for Pricing
View Details
Phenanthrene, decafluoro-
T33963-02 25 mg

Phenanthrene, decafluoro-

Sign In for Pricing
View Details
Phenanthrene, decafluoro-
T33963-03 50 mg

Phenanthrene, decafluoro-

Sign In for Pricing
View Details