Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ycnL (ycnL)

This Recombinant Bacillus subtilis Uncharacterized protein ycnL (ycnL) spans the amino acid sequence from region 1-117.

Product Specifications

Product Name Alternative

Uncharacterized protein ycnL

UniProt

P94434

Expression Region

1-117

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKETPCPNCGKPLTGDMVRSSNVPCQFRCGHCRERLYEYKVSAPIMLVSLAAIVLLIYLL MLLRNAAGSVLPAVQHVPMAVFALVCAYPVFIVSERMIAKYVIQNGNIIYRGKRKGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Amodiaquine
TRC-A634200-5MG 5 mg

Amodiaquine

Sign In for Pricing
View Details
SENP2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H1]
TA504870AM 100 µL

SENP2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H1]

Sign In for Pricing
View Details
Grp75 (HSPA9) Human Knockdown Lysate
LY300354 100 µg

Grp75 (HSPA9) Human Knockdown Lysate

Sign In for Pricing
View Details
PI 4 Kinase type 2 beta (PI4K2B) (NM_018323) Human Over-expression Lysate
LC402666 20 µg

PI 4 Kinase type 2 beta (PI4K2B) (NM_018323) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human Nicastrin/NCSTN Protein (His Tag)
PKSH031225 50 µg

Recombinant Human Nicastrin/NCSTN Protein (His Tag)

Sign In for Pricing
View Details
Mouse Wdr53 activation kit by CRISPRa
GA208005 1 Kit

Mouse Wdr53 activation kit by CRISPRa

Sign In for Pricing
View Details