Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ycnL (ycnL)

This Recombinant Bacillus subtilis Uncharacterized protein ycnL (ycnL) spans the amino acid sequence from region 1-117.

Product Specifications

Product Name Alternative

Uncharacterized protein ycnL

UniProt

P94434

Expression Region

1-117

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKETPCPNCGKPLTGDMVRSSNVPCQFRCGHCRERLYEYKVSAPIMLVSLAAIVLLIYLL MLLRNAAGSVLPAVQHVPMAVFALVCAYPVFIVSERMIAKYVIQNGNIIYRGKRKGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RSPO3 Antibody (Biotin)
KB-8035-01 50 μL

RSPO3 Antibody (Biotin)

Sign In for Pricing
View Details
RSPO3 Antibody (Biotin)
KB-8035-02 100 µL

RSPO3 Antibody (Biotin)

Sign In for Pricing
View Details
RSPO3 Antibody (Biotin)
KB-8035-03 1 mL

RSPO3 Antibody (Biotin)

Sign In for Pricing
View Details
TMEM40 Human Gene Knockout Kit (CRISPR)
KN422243 1 Kit

TMEM40 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ACTR1B Rabbit Polyclonal Antibody
TA373235 100 µL

ACTR1B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Fascin-1 (FSCN1/418), CF640R conjugate, 0.1mg/mL
BNC400418-100 1x 100 µL

Fascin-1 (FSCN1/418), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details