Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit G1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit G1 spans the amino acid sequence from region 1-118.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit G1, Mnh complex subunit G1

UniProt

P60696

Expression Region

1-118

Origin

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIKIILISLALIFVIIGALISALAAIGLLRLEDVYSRAHAAGKASTLGAMSLLFGTFLYF IATQGFVNMQLIVAIIFVLITGPLSSHMIMKAAYNIKTPYTKKTKVDEISEDLKDTKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C-MYC Monoclonal Antibody
PA7162-01 1.5 mL

C-MYC Monoclonal Antibody

Sign In for Pricing
View Details
C-MYC Monoclonal Antibody
PA7162-02 3 mL

C-MYC Monoclonal Antibody

Sign In for Pricing
View Details
C-MYC Monoclonal Antibody
PA7162-03 6 mL

C-MYC Monoclonal Antibody

Sign In for Pricing
View Details
SEH-IN-1
HY-160676 1 Each

SEH-IN-1

Sign In for Pricing
View Details
Tri-N-butyl[ (2-methyl-1,3-thiazol-4-yl) methyl]phosphonium Chloride
T8340-57 2 g

Tri-N-butyl[ (2-methyl-1,3-thiazol-4-yl) methyl]phosphonium Chloride

Sign In for Pricing
View Details
Human Islet Amyloid Polypeptide (IAPP) Protein
abx600127-01 20 µg

Human Islet Amyloid Polypeptide (IAPP) Protein

Sign In for Pricing
View Details