Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit G1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit G1 spans the amino acid sequence from region 1-118.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit G1, Mnh complex subunit G1

UniProt

A6U053

Expression Region

1-118

Origin

Staphylococcus aureus (strain JH1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIKIILISLALIFVIIGALISALAAIGLLRLEDVYSRAHAAGKASTLGAMSLLFGTFLYF IATQGFVNMQLIVAIIFVLITGPLSSHMIMKAAYNIKTPYTKKTKVDEISEDLKDTKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Bromoethyl Acetate
TRC-B750110-50G 50 g

2-Bromoethyl Acetate

Sign In for Pricing
View Details
Recombinant Mouse CXCL1/Lymphotactin1/I-TAC Protein (Gst Tag)
PDEM100187-01 20 µg

Recombinant Mouse CXCL1/Lymphotactin1/I-TAC Protein (Gst Tag)

Sign In for Pricing
View Details
Recombinant Mouse CXCL1/Lymphotactin1/I-TAC Protein (Gst Tag)
PDEM100187-02 100 µg

Recombinant Mouse CXCL1/Lymphotactin1/I-TAC Protein (Gst Tag)

Sign In for Pricing
View Details
Recombinant Mouse CXCL1/Lymphotactin1/I-TAC Protein (Gst Tag)
PDEM100187-03 500 µg

Recombinant Mouse CXCL1/Lymphotactin1/I-TAC Protein (Gst Tag)

Sign In for Pricing
View Details
Recombinant Mouse CXCL1/Lymphotactin1/I-TAC Protein (Gst Tag)
PDEM100187-04 1 mg

Recombinant Mouse CXCL1/Lymphotactin1/I-TAC Protein (Gst Tag)

Sign In for Pricing
View Details
UBE2C Human Gene Knockout Kit (CRISPR)
KN200240 1 Kit

UBE2C Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details