Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit G1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit G1 spans the amino acid sequence from region 1-118.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit G1, Mnh complex subunit G1

UniProt

A6U053

Expression Region

1-118

Origin

Staphylococcus aureus (strain JH1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIKIILISLALIFVIIGALISALAAIGLLRLEDVYSRAHAAGKASTLGAMSLLFGTFLYF IATQGFVNMQLIVAIIFVLITGPLSSHMIMKAAYNIKTPYTKKTKVDEISEDLKDTKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Coppersensor 3
TRC-B874750-10MG 10 mg

Coppersensor 3

Sign In for Pricing
View Details
Live or Dead™ Fixable Dead Cell Staining Kit *Blue Fluorescence with 405 nm Excitation*
22500-AAT 200 Tests

Live or Dead™ Fixable Dead Cell Staining Kit *Blue Fluorescence with 405 nm Excitation*

Sign In for Pricing
View Details
Fast Plus EvaGreen® qPCR Master Mix with High Rox (trial size, 100 rxn)
#31015-T 1x 1 mL

Fast Plus EvaGreen® qPCR Master Mix with High Rox (trial size, 100 rxn)

Sign In for Pricing
View Details
GNAZ Polyclonal Antibody
E-AB-18228-01 20 µL

GNAZ Polyclonal Antibody

Sign In for Pricing
View Details
GNAZ Polyclonal Antibody
E-AB-18228-02 60 µL

GNAZ Polyclonal Antibody

Sign In for Pricing
View Details
GNAZ Polyclonal Antibody
E-AB-18228-03 120 µL

GNAZ Polyclonal Antibody

Sign In for Pricing
View Details