Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit G1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit G1 spans the amino acid sequence from region 1-118.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit G1, Mnh complex subunit G1

UniProt

A6U053

Expression Region

1-118

Origin

Staphylococcus aureus (strain JH1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIKIILISLALIFVIIGALISALAAIGLLRLEDVYSRAHAAGKASTLGAMSLLFGTFLYF IATQGFVNMQLIVAIIFVLITGPLSSHMIMKAAYNIKTPYTKKTKVDEISEDLKDTKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

O-De-phenyl Ostarine
TRC-D221635-50MG 50 mg

O-De-phenyl Ostarine

Sign In for Pricing
View Details
4-Chloro-L-phenylalanine Hydrochloride
TRC-C382308-250MG 250 mg

4-Chloro-L-phenylalanine Hydrochloride

Sign In for Pricing
View Details
OCT-2 (POU2F2) (B-Cell Marker) (OCT2/2136), CF640R conjugate, 0.1mg/mL
BNC402136-500 1x 500 µL

OCT-2 (POU2F2) (B-Cell Marker) (OCT2/2136), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Diphenyl Sulfide
TRC-D491980-25G 25 g

Diphenyl Sulfide

Sign In for Pricing
View Details
Quinoline Yellow
TRC-Q701040-10G 10 g

Quinoline Yellow

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18) (KRT18/2808R), CF740 conjugate, 0.1mg/mL
BNC742808-100 1x 100 µL

Cytokeratin 18 (KRT18) (KRT18/2808R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details