Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0836 (AF_0836)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0836 (AF_0836) spans the amino acid sequence from region 1-118.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_0836

UniProt

O29422

Expression Region

1-118

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKIKKFLIQLLNMRARNTVDIIASIVGAVIIAAAISALLFSIASFLGFYSKDLSPLVYS IVSLAVIPVLRRNVPKKPILSLLTAFSIPILFLSGVEWLKLVASVLLGYLAASSLKDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GIPR Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV673618 1.0 µg DNA

GIPR Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Recombinant Human Phosphatase Orphan-1
MBS143372-01 0.002 mg

Recombinant Human Phosphatase Orphan-1

Sign In for Pricing
View Details
Recombinant Human Phosphatase Orphan-1
MBS143372-02 0.01 mg

Recombinant Human Phosphatase Orphan-1

Sign In for Pricing
View Details
Recombinant Human Phosphatase Orphan-1
MBS143372-03 1 mg

Recombinant Human Phosphatase Orphan-1

Sign In for Pricing
View Details
Recombinant Human Phosphatase Orphan-1
MBS143372-04 5x 1 mg

Recombinant Human Phosphatase Orphan-1

Sign In for Pricing
View Details
Arzoxifene HCl 10mg
A13292-10 10 mg

Arzoxifene HCl 10mg

Sign In for Pricing
View Details