Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0836 (AF_0836)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0836 (AF_0836) spans the amino acid sequence from region 1-118.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_0836

UniProt

O29422

Expression Region

1-118

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKIKKFLIQLLNMRARNTVDIIASIVGAVIIAAAISALLFSIASFLGFYSKDLSPLVYS IVSLAVIPVLRRNVPKKPILSLLTAFSIPILFLSGVEWLKLVASVLLGYLAASSLKDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Phosphoglycerate Kinase 1 (PGK1) Protein
abx166517-01 10 µg

Human Phosphoglycerate Kinase 1 (PGK1) Protein

Sign In for Pricing
View Details
Human Phosphoglycerate Kinase 1 (PGK1) Protein
abx166517-02 50 µg

Human Phosphoglycerate Kinase 1 (PGK1) Protein

Sign In for Pricing
View Details
Human Phosphoglycerate Kinase 1 (PGK1) Protein
abx166517-03 100 µg

Human Phosphoglycerate Kinase 1 (PGK1) Protein

Sign In for Pricing
View Details
Human Phosphoglycerate Kinase 1 (PGK1) Protein
abx166517-04 200 µg

Human Phosphoglycerate Kinase 1 (PGK1) Protein

Sign In for Pricing
View Details
Human Phosphoglycerate Kinase 1 (PGK1) Protein
abx166517-05 500 µg

Human Phosphoglycerate Kinase 1 (PGK1) Protein

Sign In for Pricing
View Details
Human LIPE / Hormone-sensitive lipase Recombinant Protein
R1276h 1 Each

Human LIPE / Hormone-sensitive lipase Recombinant Protein

Sign In for Pricing
View Details